DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and SFH5

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:44/222 - (19%)
Similarity:78/222 - (35%) Gaps:58/222 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 NVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDV 152
            |.|.:|....:.|...::..:.|..|..:....|:...:.....|...:.....|.|:. |...|
Yeast   115 NGDANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIGLMEKGLSLLDFTSSDNNYMTQVH-DYKGV 178

  Fly   153 AIVNGLISILDLSNVTTGHFLQMSPS--FAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIK 215
            ::......|.:.|....|.|.:..|.  :||                 :|:|.|..|..::::||
Yeast   179 SVWRMDSDIKNCSKTVIGIFQKYYPELLYAK-----------------YFVNVPTVFGWVYDLIK 226

  Fly   216 PMMSKKQQGRLYV--HGSKWEALYNQIPKQYL---PVE-YGGENGSIPELLQQWEQRILAYRNYW 274
            ..:.:..:.:..|  .|||.        .|||   |.| |||                       
Yeast   227 KFVDETTRKKFVVLTDGSKL--------GQYLKDCPYEGYGG----------------------- 260

  Fly   275 EEEKNYGTDESLRVGQPVDFESLFGLQ 301
            :::||..|.:::....|.:: .|:.||
Yeast   261 KDKKNNLTKQNVTNVHPTEY-GLYILQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024
SEC14 96..252 CDD:238099 33/163 (20%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 37/196 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.