DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:344 Identity:74/344 - (21%)
Similarity:132/344 - (38%) Gaps:89/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TAIENLNEVP-NKLDDD----------------IAALRDWIKQQPHLKARTDDQFLVNFLRGCKF 61
            ||.|.:...| :|||.|                :..||.|: |:.|......|:.::.|||...|
Mouse   226 TASEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWL-QETHKGKIPKDEHILRFLRARDF 289

  Fly    62 SLE------------RTKSKIDRFYTLRTKYP-----EFYLG--HNVDVD-KALEIFRLGTIVI- 105
            :::            |.:.::|  |.|.|..|     ::|.|  |:.|.| :.|.:.|||.:.. 
Mouse   290 NIDKAREIMCQSLTWRKQHQVD--YILDTWTPPQVLLDYYAGGWHHHDKDGRPLYVLRLGQMDTK 352

  Fly   106 -LPRPLNDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLIS----ILDLS 165
             |.|.|.:.    ||||        |.| .:|. .||.:    .|::..:....||    ::||.
Mouse   353 GLVRALGEE----ALLR--------YVL-SINE-EGLRR----CEENTKVFGRPISSWTCLVDLE 399

  Fly   166 NVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVH- 229
            .:...|..:.......::....|...|.....:..:..|..|..::.::.|.:....:.:..:: 
Mouse   400 GLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYA 464

  Fly   230 GSKWE---ALYNQIPKQYLPVEYGG-------ENGSIPELLQQWEQRILAYRNYWEEEKNYGTDE 284
            |:.::   .|.:.|.|:.:|....|       |.|.:|:.|         ||...|.|     :|
Mouse   465 GNDYQGPGGLLDYIDKEIIPDFLSGECMCDVPEGGLVPKSL---------YRTAEELE-----NE 515

  Fly   285 SLRVGQPVDFESLFGLQGS 303
            .|::.....::|....:|:
Mouse   516 DLKLWTETIYQSASVFKGA 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/53 (21%)
SEC14 96..252 CDD:238099 32/172 (19%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 68/313 (22%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 10/45 (22%)
CRAL_TRIO 326..490 CDD:279044 37/181 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.