DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and SEC14L6

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:366 Identity:76/366 - (20%)
Similarity:126/366 - (34%) Gaps:121/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKID 71
            |||..:|    :|.:....:.|.::||           ...||.||:.:|:...|.|::::..: 
Human    11 LSPSQEK----SLAQFRENIQDVLSAL-----------PNPDDYFLLRWLQARSFDLQKSEDML- 59

  Fly    72 RFYTLRTKYPEFYLGH---NVDVDKALEIFRLGTIVILPRPLNDNG------------------- 114
                  .|:.||....   |:...:..|:.||         .|.||                   
Human    60 ------RKHMEFRKQQDLANILAWQPPEVVRL---------YNANGICGHDGEGSPVWYHIVGSL 109

  Fly   115 -PRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIV-------NGLISILD-LSNVTTG 170
             |:..||     ..||   ||:.|.:....:::|.|.::...       .|:.:.|| ..|..|.
Human   110 DPKGLLL-----SASK---QELLRDSFRSCELLLRECELQSQKPHWTRGTGISAPLDRRGNCNTA 166

  Fly   171 ------HFLQMSPSFAKKMTVFQEEALPLR---PQGIHF---------------------INTPN 205
                  ...::.....|.:.:|..|.|.||   ..||..                     :..|.
Human   167 IWPPMDRHKELGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPK 231

  Fly   206 GFDTIFNMIKPMMSKKQQGRLYVHGSKW-EALYNQIPKQYLPVEYGGE----------------N 253
            .|...||::|..||::.:.::.:.|..| :.|...|....||||:||.                .
Human   232 LFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYG 296

  Fly   254 GSIPELLQQWEQRILAYRNYWEEEKNYGTDESLRVGQPVDF 294
            |.:|:.....:|..|.|    |..::.|...||:|...:.|
Human   297 GEVPKSYYLCKQVRLQY----EHTRSVGRGSSLQVENEILF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 9/41 (22%)
SEC14 96..252 CDD:238099 45/214 (21%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.