DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and TTPA

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_000361.1 Gene:TTPA / 7274 HGNCID:12404 Length:278 Species:Homo sapiens


Alignment Length:268 Identity:79/268 - (29%)
Similarity:141/268 - (52%) Gaps:11/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKTAIENLNEVPNK---LDDDIAALRDWIKQQ--PHLKARTDDQFLVNFLRGCKFSLERTKSKID 71
            |.:|...||.:|:.   |...:||||...::.  |.......|.||:.|||...|.|:.....:.
Human     7 QPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARDFDLDLAWRLLK 71

  Fly    72 RFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYTLQEVN 136
            .:|..|.:.||  :..::.....:.:.:.|...:| |..:..|.::.:.|:|.:||..:|..:|.
Human    72 NYYKWRAECPE--ISADLHPRSIIGLLKAGYHGVL-RSRDPTGSKVLIYRIAHWDPKVFTAYDVF 133

  Fly   137 RAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFI 201
            |.:.:..::::.|.:.. .||:.:|.||......|..|::||.|||:.....::.||:.:|||.|
Human   134 RVSLITSELIVQEVETQ-RNGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLI 197

  Fly   202 NTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW-EALYNQIPKQYLPVEYGGENGSIPELLQQWEQ 265
            |.|..|..:|:||||.:::|.:.|:::||:.: ::|....| ..||:|||||..|:.::.|:|..
Human   198 NEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFP-DILPLEYGGEEFSMEDICQEWTN 261

  Fly   266 RILAYRNY 273
            .|:...:|
Human   262 FIMKSEDY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 13/43 (30%)
SEC14 96..252 CDD:238099 49/156 (31%)
TTPANP_000361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 5/12 (42%)
CRAL_TRIO_N <40..73 CDD:215024 9/32 (28%)
CRAL_TRIO 99..248 CDD:395525 49/151 (32%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.