DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:336 Identity:71/336 - (21%)
Similarity:127/336 - (37%) Gaps:98/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKIDRFYTLRTKYPEF 83
            :.::..|.::.:|..|:.::.........||.||:.:||...|.|:::::.:       .|:.||
Mouse     5 VGDLSPKQEEALAKFRENVQDVLPTLPNPDDYFLLRWLRARSFDLQKSEAML-------RKHVEF 62

  Fly    84 YLGHNVDVDKAL-----EIFR---------------------LGTIVILPRPLNDNG-----PRL 117
              ....|:||.:     |:.:                     :|       ||:..|     .:.
Mouse    63 --RKQKDIDKIISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIG-------PLDAKGLLFSASKQ 118

  Fly   118 ALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMS-PSFAK 181
            .|||....| .:..|||.     :.|...|.:.    :..:..|.|...:...|..:.: .::.:
Mouse   119 DLLRTKMRD-CELLLQEC-----IQQTTKLGKK----IETITMIYDCEGLGLKHLWKPAVEAYGE 173

  Fly   182 KMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW-EALYNQIPKQYL 245
            .:|:| ||..|...:.:..:..|..|...:|:|||.:|:..:.::.|.|:.| |.|...|....|
Mouse   174 FLTMF-EENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQL 237

  Fly   246 PVEYGGE----------------NGSIP-------ELLQQWEQRILAYRNYWEEEKNYGTDESLR 287
            ||||||.                .|.||       ::.||:|..:...|         |:...  
Mouse   238 PVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHTVQVSR---------GSSHQ-- 291

  Fly   288 VGQPVDFESLF 298
                |::|.||
Mouse   292 ----VEYEILF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 10/41 (24%)
SEC14 96..252 CDD:238099 41/183 (22%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 10/52 (19%)
SEC14 76..244 CDD:214706 41/185 (22%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.