DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:345 Identity:66/345 - (19%)
Similarity:125/345 - (36%) Gaps:107/345 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTAI---ENLNEV----PNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLE 64
            |||:..:|..   ||:.:|    ||                      .||.||:.:||...|.|:
  Rat     8 LSPKQAETLAKFRENVQDVLPALPN----------------------PDDYFLLRWLRARNFDLQ 50

  Fly    65 RTKSKIDRFYTLRTKYPEFYLGHNVDVD--------KALEIFRLGTIVILPR-----------PL 110
            ::::.:       .||.||  ...:|:|        :.::.:..|.:....|           ||
  Rat    51 KSEAML-------RKYMEF--RKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPLWYDIIGPL 106

  Fly   111 NDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAI------VNGLISILDLSNVTT 169
            :   |:..|..:...|..|..:::..|        :|.|.|:..      :..::.|.|...:..
  Rat   107 D---PKGLLFSVTKQDLLKTKMRDCER--------ILHECDLQTERLGRKIETIVMIFDCEGLGL 160

  Fly   170 GHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW- 233
            .||.:......::.....||..|...:.:..:.....|...:|::||.:|:..:.::.|.|:.| 
  Rat   161 KHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWK 225

  Fly   234 EALYNQIPKQYLPVEYGGE----------------NGSIPELLQQWEQRILAYRNYWEEEKNYGT 282
            |.|...|..:.||..:||.                .|.||:.:            |..::.....
  Rat   226 EGLLKLISPEELPAHFGGTLTDPDGNPKCLTKINYGGEIPKSM------------YVRDQVKTQY 278

  Fly   283 DESLRVGQ----PVDFESLF 298
            :.|:::.:    .|::|.||
  Rat   279 EHSVQISRGSSHQVEYEILF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 8/41 (20%)
SEC14 96..252 CDD:238099 33/173 (19%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 14/74 (19%)
SEC14 76..245 CDD:214706 34/179 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.