DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:322 Identity:65/322 - (20%)
Similarity:120/322 - (37%) Gaps:84/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKID 71
            |||: |:.|:....|:          |:|.:...|    :.||.||:.:||...|.|::::..: 
  Rat     8 LSPQ-QQEALTRFREI----------LQDVLPTLP----KADDFFLLRWLRARNFDLKKSEDML- 56

  Fly    72 RFYTLRTKYPEFYLGHNVDVDKAL-----EIFRLGTIVILPRPLNDNGPRLALLRMAC------- 124
                  .|:.||  .:..|:|..|     |:.|          |.|:|.........|       
  Rat    57 ------RKHVEF--RNQQDLDHILTWQPPEVIR----------LYDSGGLCGYDYEGCPVWFDLI 103

  Fly   125 --YDPS----KYTLQEVNRAAGLMQQIMLDEDDVAI------VNGLISILDLSNVTTGHFLQMSP 177
              .||.    ..:.|::.|....:.:::|.|.::..      |..::.:.|:..::..|..:.:.
  Rat   104 GTLDPKGLFMSASKQDLIRKRIKVCEMLLHECELQSQKLGRKVERMVMVFDMEGLSLRHLWKPAV 168

  Fly   178 SFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW--EALYNQI 240
            ...::.....|...|...:.:..|..|..|...||::|..:.:..|.::.:.|..|  |.|....
  Rat   169 EVYQQFFAILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLKFMS 233

  Fly   241 PKQYLPVEYGGE----------------NGSIPELLQ-------QWEQRILAYRNYWEEEKN 279
            |.| ||||:||.                .|.:|:...       |:|..::..|....:.:|
  Rat   234 PDQ-LPVEFGGTMTDPDGNPKCLTKINYGGDVPKHYHLSSQERPQYEHNVVVGRGSSHQVEN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/41 (27%)
SEC14 96..252 CDD:238099 35/176 (20%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 13/66 (20%)
SEC14 76..244 CDD:214706 35/178 (20%)
GOLD_2 284..379 CDD:404736 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.