DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and sec14l5

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_031749906.1 Gene:sec14l5 / 493292 XenbaseID:XB-GENE-953433 Length:793 Species:Xenopus tropicalis


Alignment Length:354 Identity:70/354 - (19%)
Similarity:135/354 - (38%) Gaps:85/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAIRPLSPELQKTAIENLNEVP-NKLDDD----------------IAALRDWIKQQPHLKARTDD 49
            |:.:...|.....|...|:..| :|||.|                :..||.|: |:.|......|
 Frog   214 PSSKDGLPSSPTAATHELSSTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWL-QETHKGKIPKD 277

  Fly    50 QFLVNFLRGCKFSLERTKSKIDRFYTLRTKY---------------PEFYLG--HNVDVD-KALE 96
            :.::.|||...|::::.:..:.:..|.|.::               .::|.|  |:.|.| :.|.
 Frog   278 EHILRFLRARDFNIDKAREILCQSLTWRKQHHVDYLLSTWDPPQVLHDYYAGGWHHHDRDGRPLY 342

  Fly    97 IFRLGTIVI--LPRPLNDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLI 159
            :.|||.:..  |.|.|.:.    :|||         .:..:|. .||.:    .|::..|....|
 Frog   343 VLRLGQMDTKGLVRALGEE----SLLR---------HVLSINE-EGLRR----CEENTNIFGRPI 389

  Fly   160 S----ILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSK 220
            |    ::||..:...|..:.......::....|...|.....:..:..|..|..::.::.|.:.:
 Frog   390 SSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDE 454

  Fly   221 KQQGRLYVH-GSKWE---ALYNQIPKQYLPVEYGG-------ENGSIPELLQQWEQRILAYRNYW 274
            ..:.:..:: |:.::   .|.:.|.|:.:|...||       |.|.:|:.|         ||...
 Frog   455 NTRKKFLIYAGNDYQGPGGLIDYIDKEVIPDFLGGECMCEVSEGGMVPKAL---------YRTPE 510

  Fly   275 EEEKNYGTDESLRVGQPVDFESLFGLQGS 303
            |.|     ::.:|:.....::|....:||
 Frog   511 ELE-----NDDIRLWTETIYQSASVFKGS 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 10/41 (24%)
SEC14 96..252 CDD:238099 31/172 (18%)
sec14l5XP_031749906.1 PRELI 17..173 CDD:398400
CRAL_TRIO_N 256..301 CDD:215024 10/45 (22%)
CRAL_TRIO 326..490 CDD:395525 36/181 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.