DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG11550

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:295 Identity:85/295 - (28%)
Similarity:144/295 - (48%) Gaps:29/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKIDRFYTLRTKYPEFYLGHNVDVDK 93
            ::....|||..|||:..|..:...::|...|::|:|..|..:|...|.||...||::  |:|.::
  Fly    20 EVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFV--NLDCER 82

  Fly    94 ALEIFR-LGTIVILPRP-LNDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVN 156
            . ||.| :.|:.|:|.| ....|.|:.|.::...:.|.|...:|.:...::....:.||  .|..
  Fly    83 P-EIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLYCMVFDFWMYED--GIQP 144

  Fly   157 GLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKK 221
            |.:.::||.|.:.||..::.....||...:.:||..:|..|.||||.....|.|..::.|.|.|:
  Fly   145 GHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKE 209

  Fly   222 QQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELLQQWEQRILAYRNYW-----------E 275
            ....|::| |..:..|..:|::.||.||||          |.|:..:|...|:           |
  Fly   210 LTTVLHMH-SDLKEFYKFVPQEMLPKEYGG----------QLEEANVAKEIYYKKLLDNRKEMIE 263

  Fly   276 EEKNYGTDESLRVGQPVDFESLFGLQGSFRQLNVD 310
            .|..:..:|.||.|:..:...|||::|:|::|::|
  Fly   264 FETRHQVNEKLRPGKAKNASDLFGIEGNFKKLDID 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 12/41 (29%)
SEC14 96..252 CDD:238099 47/157 (30%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 44/157 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.