DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG32407

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:231 Identity:43/231 - (18%)
Similarity:83/231 - (35%) Gaps:52/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PELQKTAIENLNEVPNKLDDDIAALRDWIKQQP-------HLKARTD-DQFLVNFLRGCKFSLER 65
            |..|....|.:::|...:      |:...|:.|       .||..|| |.::...|:...|.:|:
  Fly     2 PSDQDPTPEQISQVKTSI------LQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEK 60

  Fly    66 TKSKIDRFYTLRTKYPEFYLGHNVDVDKA---LEIFRLGTIVILPRPLNDNGPRLALLRMACYDP 127
            ..:::......|..:..:      |:.:|   .|....|:|.:..:  :.:|..|.:|.:..:..
  Fly    61 CITRLWDNLAWRKSFGVY------DITEANLNQEFLNDGSIYVHNK--DRDGKPLLILTIKKHSK 117

  Fly   128 SK----------YTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKK 182
            |:          :.::.:.|.:.|        |.:.|...:.. ..|||:..|        |.|.
  Fly   118 SRNQEDLLRILVFWIERLQRDSNL--------DKITIFMDMTG-AGLSNLDMG--------FIKS 165

  Fly   183 MTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMM 218
            :....|...|..|..|...:.|...|..|.::|..:
  Fly   166 IIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/49 (22%)
SEC14 96..252 CDD:238099 25/133 (19%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.