DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:333 Identity:70/333 - (21%)
Similarity:127/333 - (38%) Gaps:88/333 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NKLDDD----------------IAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLE-------- 64
            :|||.|                :..||.|: |:.|......|:.::.|||...|:::        
  Rat   238 DKLDADYIKRYLGDLTPLQESCLIRLRQWL-QETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ 301

  Fly    65 ----RTKSKIDRFYTLRTKYP-----EFYLG--HNVDVD-KALEIFRLGTIVI--LPRPLNDNGP 115
                |.:.::|  |.|.|..|     ::|.|  |:.|.| :.|.:.|||.:..  |.|.|.:.  
  Rat   302 SLTWRKQHQVD--YILDTWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEE-- 362

  Fly   116 RLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLIS----ILDLSNVTTGHFLQMS 176
              ||||        |.| .:|. .||.:    .|::..:....||    ::||..:...|..:..
  Rat   363 --ALLR--------YVL-SINE-EGLRR----CEENTKVFGRPISSWTCLVDLEGLNMRHLWRPG 411

  Fly   177 PSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVH-GSKWE---ALY 237
            .....::....|...|.....:..:..|..|..::.::.|.:....:.:..:: |:.::   .|.
  Rat   412 VKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLL 476

  Fly   238 NQIPKQYLPVEYGG-------ENGSIPELLQQWEQRILAYRNYWEEEKNYGTDESLRVGQPVDFE 295
            :.|.|:.:|....|       |.|.:|:.|         ||...|.|     :|.|::.....::
  Rat   477 DYIDKEIIPDFLSGECMCDVPEGGLVPKSL---------YRTPEELE-----NEDLKLWTETIYQ 527

  Fly   296 SLFGLQGS 303
            |....:|:
  Rat   528 SASVFKGA 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/53 (21%)
SEC14 96..252 CDD:238099 32/172 (19%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 10/45 (22%)
CRAL_TRIO 327..491 CDD:279044 37/181 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.