DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG1902

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:316 Identity:110/316 - (34%)
Similarity:171/316 - (54%) Gaps:10/316 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAIRPLSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLER 65
            |..||.|.|||.:.|...|.|.|:.....|.|||.||.:|.:|:|||||||||.|||.|::.:|.
  Fly     1 MAKIRSLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEE 65

  Fly    66 TKSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKY 130
            .|.::..:||.::|..|...|..|| ||.:|:.|.|....||:|:...|||:...||...:|||:
  Fly    66 AKKRVLFYYTYKSKERELLKGRQVD-DKLIELARSGIFATLPKPIGPGGPRIHYTRMGHIEPSKH 129

  Fly   131 TLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRP 195
            ::.::.|......:|.::.||...:.|::.|:|.:.:.....||..|...|:|..|.|..:|...
  Fly   130 SVSDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANL 194

  Fly   196 QGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELL 260
            ...|.:|.......:..:::.:|  ||:..|::| |...:|...|..:|||||.||:|||:.:.:
  Fly   195 VATHIVNASRETQFVLGLVRNVM--KQKELLHIH-STVASLRKAIGLEYLPVEMGGDNGSLSDAM 256

  Fly   261 QQWEQRILAYRNYWEEEKNYGTDESLRVGQPVDFESLFGL------QGSFRQLNVD 310
            .::|.::|::..|:.|::.||.||.||.....|.|....|      .|:||.:|.|
  Fly   257 TRYETQLLSFSPYFTEDERYGVDEKLREASEKDQERGAPLVTDVPNDGTFRMINFD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 23/41 (56%)
SEC14 96..252 CDD:238099 45/155 (29%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 23/40 (58%)
CRAL_TRIO 100..248 CDD:279044 43/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464523
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.