DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG10026

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:249 Identity:71/249 - (28%)
Similarity:125/249 - (50%) Gaps:15/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PELQKTAIENLNEVPNKLDDDIAALRDWIKQ----QPHLKARTDDQFLVNFLRGCKFSLERTKSK 69
            ||..:...:...|.|:..|..|...|::|.:    |||   |:|.::|..|||...:.:|.:...
  Fly    25 PEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPH---RSDAKYLEKFLRARYWKIENSYKL 86

  Fly    70 IDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILP-RPLND-NGPRLALLRMACYDPSKYTL 132
            :..:|..|.:...||     :..:.|::..:|...||. .|..| :|.|:.:.|...:.|::.|:
  Fly    87 LCSYYRFREQNKSFY-----EKVRPLDLRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTV 146

  Fly   133 QEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQG 197
            .::.||..::|::...|....||.| :.|.||.::...|.|.:|||.|:||......::|:|...
  Fly   147 DDIFRATIVLQELGSLEPISQIVGG-VGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSA 210

  Fly   198 IHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGG 251
            :|.:|....|:..|.:.||.::...:.:||:|||...:|:..|..::||..|||
  Fly   211 LHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 13/45 (29%)
SEC14 96..252 CDD:238099 48/158 (30%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 14/49 (29%)
SEC14 112..265 CDD:238099 48/154 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.