DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and Ku80

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:294 Identity:58/294 - (19%)
Similarity:105/294 - (35%) Gaps:86/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAIRPLSPELQKTAIENLNEVPNKLD--DDIAALRDWIKQQPHLKARTD----DQFLVNFLRGCK 60
            ||:|....|..:   |.||.:...:|  |....|||  .|||...|:.|    |.....|.:...
  Fly   410 PALRTTKTECSE---EQLNAIDQLIDSTDLECTLRD--TQQPRPWAQNDLLPFDALPSIFEQNVM 469

  Fly    61 FSLERTKSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIV-ILPRPLNDNGPRLALLRMAC 124
            ..|||   |:              :..|...||.|:......:. .:|.||.:...|.|.:....
  Fly   470 DILER---KV--------------IYDNDKEDKMLKDKNFADVFWRVPDPLEEKSKRAAAIVKKL 517

  Fly   125 YDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEE 189
            : |.:|     :||   .|:.:|.::...  ||:.             ::..|:         |:
  Fly   518 F-PLRY-----SRA---WQEKLLAKEQAE--NGVA-------------VKSEPA---------EK 549

  Fly   190 ALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEAL----------YNQIPKQY 244
            .:||...|:..|:..:.|..:...:..:.:..::      .::::||          ..|..||.
  Fly   550 EIPLPSDGVGLIDPISDFRRVLASVHTISNATER------DARFQALAADTRVVIITLLQRRKQN 608

  Fly   245 LPVEYGGENGSIPELLQQWEQRILAYRNYWEEEK 278
            :        |.:.||:..:.|..:.:..:.|.:|
  Fly   609 I--------GQLGELITLYRQSCIDFNTFLEYDK 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 14/45 (31%)
SEC14 96..252 CDD:238099 25/166 (15%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 34/141 (24%)
Ku_PK_bind 562..663 CDD:285938 12/87 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.