DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG5973

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:290 Identity:73/290 - (25%)
Similarity:138/290 - (47%) Gaps:31/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKIDRFYTLR 77
            |.|.:.|.|||...:..|..||:.|:.:.:|....||::::.|||...:..|....::..||.::
  Fly    37 KKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMK 101

  Fly    78 TKYPEFYLG---HNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMA-CYDPSKYTLQEVNRA 138
            .||     |   .|:...|...:|....:.:||: .:.:|.||.:|... .:.||:..|.::.|.
  Fly   102 LKY-----GAACENIIPSKLRNVFEANILNLLPQ-RDQHGRRLLVLEAGKKWKPSQVPLVDLFRG 160

  Fly   139 AGLMQQIMLDE--DDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFI 201
               :|..:|..  :..:.:.|.:.|:|:..:...|..|.:||||..:..:.:|.:.:|.:.:|.:
  Fly   161 ---IQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVHIV 222

  Fly   202 NTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELLQQWE-- 264
            |....|:.:|.:.||.:.:|.:.|::.||..:::|.:.|..:.||.:|||.        ..||  
  Fly   223 NNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGS--------ATWELP 279

  Fly   265 -QRIL-----AYRNYWEEEKNYGTDESLRV 288
             .::|     .|...:|...:||..|..::
  Fly   280 HGKVLGEFFECYSKDYELADSYGYTEGYKM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/41 (27%)
SEC14 96..252 CDD:238099 40/158 (25%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/44 (25%)
SEC14 116..272 CDD:238099 39/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.