DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG5958

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:274 Identity:77/274 - (28%)
Similarity:130/274 - (47%) Gaps:18/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKID 71
            |.||..:.|...|.|......:.|..||:.:|..|.|..:.||.||..|||.|.|..|....|:.
  Fly    18 LKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMK 82

  Fly    72 RFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMA-CYDPSKYTLQEV 135
            ...:.|.:|.....|  :.|::..|.|..|:::.:.:..:..|.|:.::... .:|||..|..|:
  Fly    83 TTASFRKEYASLVRG--LLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEM 145

  Fly   136 NRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHF 200
            .|.. .|..:....::...|.|::.|:|...::......:||||:|::..|.:||:|||.:.:||
  Fly   146 FRML-YMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHF 209

  Fly   201 INTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGG-----ENGSI---P 257
            :..|..|:.::::.||.:.:|...|::.|||..::|...:....||..|.|     :.|.:   |
  Fly   210 VKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLPAIDYGGVEWFP 274

  Fly   258 ELLQQ------WEQ 265
            .|.||      |.|
  Fly   275 ALEQQAQYVEEWSQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 17/41 (41%)
SEC14 96..252 CDD:238099 43/161 (27%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 17/43 (40%)
CRAL_TRIO 111..261 CDD:279044 39/150 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.