DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG31826

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:308 Identity:68/308 - (22%)
Similarity:113/308 - (36%) Gaps:78/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTA-----IENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERT 66
            |:..:..||     ||.|.::..|.:|              |:..|:|..|..||...::...:.
  Fly     4 LTARVDHTAEQIFKIEQLRQLVEKCED--------------LRVGTEDTLLTKFLHYTRWDTIKA 54

  Fly    67 KSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMAC---YDPS 128
            ...|..:|..:.::|.:...|  .::...::| .||......|..|...|:.::....   .|..
  Fly    55 YQAIHDYYEFKRRHPTWVARH--PIEHYRQLF-YGTHCRYVMPQADRSGRVLVVFKTVDGFQDYP 116

  Fly   129 KYTLQEVNRAAGLMQQIMLDEDDVAI----------VNGLISILDLSNVTTGHFLQMSPSFAKKM 183
            .|.            |.:::.||:..          .||:..|.||.........|.||:|   |
  Fly   117 DYL------------QSLVEMDDLIFESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPAF---M 166

  Fly   184 TVFQEE--ALPLRPQGIHFINTPNGF-----DTIFNMIKPMMSKKQQGRLYVH-GSKWEALYNQI 240
            .|..|:  .||...:.:|.|.  .||     .|:|   .|.|:|:.:.:::.| |.....|...:
  Fly   167 KVVNEKNGVLPFSQRIVHIIQ--RGFLMHVTSTLF---MPFMNKEFKEKIFTHDGRHLSKLREMV 226

  Fly   241 PKQYLPVEYGGENGSIPE-------LLQQWEQRILAYRNYWEEEKNYG 281
            ..:.||.||||...::.:       |.|..|        |.|:.:.||
  Fly   227 GYESLPAEYGGPATNVLDTNLIFNHLSQNAE--------YLEKLQTYG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 7/41 (17%)
SEC14 96..252 CDD:238099 42/176 (24%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 12/57 (21%)
CRAL_TRIO 92..237 CDD:279044 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.