DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG3823

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:304 Identity:74/304 - (24%)
Similarity:138/304 - (45%) Gaps:22/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NLNEVPNKLDDD-----IAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKIDRFYTLR 77
            :|||   |.:|.     |:.|:||::.||.|........|..||...:..|...:..::..|.||
  Fly     3 HLNE---KAEDQLMTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLR 64

  Fly    78 TKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYTLQEVNRAAGLM 142
            .|:...::..:.....:.::.::..:|.||....:|. :|...|:..:|..|:     |..|.:.
  Fly    65 NKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENN-KLLFYRLIDFDADKF-----NFTAAIK 123

  Fly   143 QQIML------DEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFI 201
            ...|:      .|::..:.:|.|.:.|::..|..|..:.:....:....|.:||.|:|.:.||.:
  Fly   124 VFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVL 188

  Fly   202 NTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELLQQWEQR 266
            |.|:..|.:..::||.:..:....::.|....:..|...|:..||.|||||.|.:.:|..||.|.
  Fly   189 NCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQL 253

  Fly   267 ILAYRNYWEEEKNYGTDESLRVGQPVDFESLFGLQGSFRQLNVD 310
            :...|:|..:.:|:..::..:.||....:|  |:....|.|.:|
  Fly   254 LKEQRDYLMDTENWQINKIKKNGQRKSSDS--GVTEGLRSLEID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/41 (27%)
SEC14 96..252 CDD:238099 37/161 (23%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 37/154 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447107
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.