DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CG3191

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:292 Identity:77/292 - (26%)
Similarity:134/292 - (45%) Gaps:17/292 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SPELQKTAIENLNE-VPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKF-SLERTKSKI 70
            |.:||:....:.:| ...|.:.|:..|.:|.:|...|....|...|..|.: |.| .:|.|:..|
  Fly    15 SEQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQ-CMFGDVEETRKLI 78

  Fly    71 DRFYTLRTKYPEFYLGHN-VDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYTLQE 134
            :..|.||.::|..::..: :|.| :...|....|:.|| .|..:..:::|.....::.||....|
  Fly    79 EVNYALRNRHPHLFIKRDPLDAD-SKRTFDYADILPLP-GLTPDKCKVSLYCFREFEASKMHHTE 141

  Fly   135 VNRAAGLMQQI-MLDEDDVA----IVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLR 194
            ..||..::... .:..||:|    :..|.:.|.|:...|..|..:::.|..:....|.:.|.|:|
  Fly   142 DTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVR 206

  Fly   195 PQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPEL 259
            .:.||.||.|...|.|.:::||.:|.:....:..|......||..:|::.||.||||..||:..|
  Fly   207 LRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEAL 271

  Fly   260 LQQWEQRILAYRNY------WEEEKNYGTDES 285
            ....::.::.:|:|      |...|....:||
  Fly   272 RTHTQKALVEHRDYLMDPDHWVVVKPEKRNES 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 12/42 (29%)
SEC14 96..252 CDD:238099 43/160 (27%)
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 40/149 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447098
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.