DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and SEC14L4

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_016884276.1 Gene:SEC14L4 / 284904 HGNCID:20627 Length:465 Species:Homo sapiens


Alignment Length:333 Identity:67/333 - (20%)
Similarity:118/333 - (35%) Gaps:84/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAIRPLSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERT 66
            |.||..|.:.::...:.|..:||                      .||.||:.:||...|.|:::
Human    69 PTIRSSSAQFRENLQDLLPILPN----------------------ADDYFLLRWLRARNFDLQKS 111

  Fly    67 KSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRP----LNDNGPRLALLRMAC--- 124
            :..:.|....|.:.         |:|         .||....|    |.|:|.........|   
Human   112 EDMLRRHMEFRKQQ---------DLD---------NIVTWQPPEVIQLYDSGGLCGYDYEGCPVY 158

  Fly   125 ------YDPSKYTL----QEVNRAAGLMQQIMLDEDDVAI------VNGLISILDLSNVTTGHFL 173
                  .||....|    |::.|....:.:::|.|.::..      :...:.:.|:..::..|..
Human   159 FNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLW 223

  Fly   174 QMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW-EALY 237
            :.:....::.....|...|...:.:..|..|..|...||::|..||::.:.::.:.|..| :.|.
Human   224 KPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELT 288

  Fly   238 NQIPKQYLPVEYGGE----------------NGSIPELLQQWEQRILAYRNYWEEEKNYGTDESL 286
            ..|....||||:||.                .|.:|:.....||..|.|    |..::.|...||
Human   289 KFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQY----EHTRSVGRGSSL 349

  Fly   287 RVGQPVDF 294
            :|...:.|
Human   350 QVENEILF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 8/41 (20%)
SEC14 96..252 CDD:238099 35/179 (20%)
SEC14L4XP_016884276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.