DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and SEC14L2

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens


Alignment Length:342 Identity:73/342 - (21%)
Similarity:127/342 - (37%) Gaps:101/342 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKID 71
            |||. ||.|:....|   .:.|.:.||           ...||.||:.:||...|.|:::::.: 
Human     8 LSPR-QKEALAKFRE---NVQDVLPAL-----------PNPDDYFLLRWLRARSFDLQKSEAML- 56

  Fly    72 RFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYD----PSKYTL 132
                  .|:.||....::|     .|.......::.:.|:..        |..||    |..|.:
Human    57 ------RKHVEFRKQKDID-----NIISWQPPEVIQQYLSGG--------MCGYDLDGCPVWYDI 102

  Fly   133 QEVNRAAGLM-----QQIM---LDEDDVAI-------------VNGLISILDLSNVTTGHFLQMS 176
            .....|.||:     |.::   :.|.::.:             |..:..|.|...:...|..:.:
Human   103 IGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPA 167

  Fly   177 -PSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW-EALYNQ 239
             .::.:.:.:| ||..|...:.:..:..|..|...:|:|||.:|:..:.::.|.|:.| |.|...
Human   168 VEAYGEFLCMF-EENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKH 231

  Fly   240 IPKQYLPVEYGGE----------------NGSIP-------ELLQQWEQRILAYRNYWEEEKNYG 281
            |....:||||||.                .|.||       ::.||:|..:...|         |
Human   232 ISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISR---------G 287

  Fly   282 TDESLRVGQPVDFESLF 298
            :...      |::|.||
Human   288 SSHQ------VEYEILF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 10/41 (24%)
SEC14 96..252 CDD:238099 38/182 (21%)
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 14/66 (21%)
SEC14 76..244 CDD:214706 37/176 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.