DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and R03A10.5

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:336 Identity:50/336 - (14%)
Similarity:101/336 - (30%) Gaps:130/336 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELQKTAIENLNEVPNKLDDDIA--------ALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLE-R 65
            ::|...::.:.::...:.|||:        .|| |::....|.       :....|..||.|. |
 Worm     7 DIQPYDLKKIQQLRELVKDDISEYYNTDFNILR-WLQGHNTLP-------IEEIARKMKFHLNLR 63

  Fly    66 TKSKIDRFYTLRTKYP-----EFYL----GH--NVDVD----------------KALEIFRLGTI 103
            ....:|..:.....:|     ::.:    ||  ||.|:                ..||:.|    
 Worm    64 AAWNLDELHKKERNHPIHKHWKYGITGPSGHMDNVIVNIEQCGKTDYTGMMETYSILEVMR---- 124

  Fly   104 VILPRPLNDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVA---------IVNGLI 159
                            .||...:...:.:.|:....|....|:...|...         :|.|  
 Worm   125 ----------------ARMVDLEQMLHHVMELEAKTGKQAWILYVMDITGLQYNKKLYDLVTG-- 171

  Fly   160 SILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQG 224
            |:..|::....|:::|...|..                   :..|:....::.:::|::.:|.:.
 Worm   172 SMKSLADFMADHYVEMIKYFVP-------------------VCVPSFATALYVVVRPLLPEKTRE 217

  Fly   225 RLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELLQQWEQRILAYR------NYWEEEKN-YGT 282
            ::.:.|.                             ..|...:|.|.      :.|..|.: :|.
 Worm   218 KVRLIGE-----------------------------TNWRDDVLQYAIHSSLPSIWNNENHTFGG 253

  Fly   283 DESLRVGQPVD 293
            ...|.:|.|.|
 Worm   254 FIELPIGYPTD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 10/50 (20%)
SEC14 96..252 CDD:238099 19/164 (12%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 31/241 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.