DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and cgr-1

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:349 Identity:71/349 - (20%)
Similarity:125/349 - (35%) Gaps:99/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IEN----LNEVPNKLDDDIAALRDWIKQQPHLKARTDDQF-LVNFLRGCKFSLERTKSKIDRFYT 75
            :||    |||:.....|.||.||...|.........|..| |:.:|.|..:.::....|:.  |.
 Worm     3 VENHYPHLNELTAHQKDKIAELRSKTKDILATYPEYDTDFSLLRWLMGWDYKIDVIVPKMR--YA 65

  Fly    76 LRTKYPEFYLGHN----VDVDK----------ALEIF--------RLGTIVIL-------PRPLN 111
            :.|.   ..||.|    ..||:          ..|.|        :.|.:|.:       |:.|.
 Worm    66 VETL---VNLGMNNKQTTSVDQINRDIKNMSAVAEYFPGGIMGKSKRGDVVYMQAMAKAHPKTLV 127

  Fly   112 DNGPRLALLRMACYDPS------KYTLQEVNRAAGLMQQIMLDED----DVAIVNGLISILDLSN 166
            ..||...|.::...:..      :.|.||..|..|::  |::|.|    |:.....|...:.|..
 Worm   128 KAGPTSQLFQLCISETEMSFKIIRQTEQETERKMGVI--IIMDLDGFSMDLLYTPTLKVYMSLLT 190

  Fly   167 VTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGS 231
            :....|    |.||::               |:.||.|.....::.|:.|::|.:.:.::.....
 Worm   191 MLQNIF----PDFARR---------------IYIINCPAMMSAVYAMVSPVLSSQTREKVRFLDK 236

  Fly   232 KWE-ALYNQIPKQYLPVEYGG------------ENGSIPELLQQWEQRILAYRNYWEEEKNYGTD 283
            .|: .|..:|.::.:.:.:||            ..|.:||.|  |         |.:..|..|  
 Worm   237 DWKNHLIEEIGEENIFMHWGGVKKHEHPCGDIRMGGKVPESL--W---------YADSHKLEG-- 288

  Fly   284 ESLRVGQPVDFES---LFGLQGSF 304
            :..::..|...::   ::|..|.:
 Worm   289 DRTKIAVPARSKTEIKMYGESGKY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/42 (26%)
SEC14 96..252 CDD:238099 36/193 (19%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 34/186 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.