DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and CLVS1

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:288 Identity:84/288 - (29%)
Similarity:146/288 - (50%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPE-LQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLK-ARTDDQFLVNFLRGCKFSLERTKSK 69
            |||| ::|..:| |||.|:.|..||..:||.|..:|.:. .||||.|::.|||..||      .:
Human    30 LSPETIEKARLE-LNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKF------HQ 87

  Fly    70 IDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDN-----------GPRLALLRMA 123
            .|.|..|...:.  |...|:|:.|..:....|    :.|.|.|.           |.::.||..|
Human    88 ADAFRLLAQYFQ--YRQLNLDMFKNFKADDPG----IKRALIDGFPGVLENRDHYGRKILLLFAA 146

  Fly   124 CYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQE 188
            .:|.|:.:..::.||..|..::::::.::.| ||.|.|:|.||.:.....:::||..|......:
Human   147 NWDQSRNSFTDILRAILLSLEVLIEDPELQI-NGFILIIDWSNFSFKQASKLTPSILKLAIEGLQ 210

  Fly   189 EALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGEN 253
            ::.|.|..|:||:|.|.....::.:|||.:..|.:.|:::||:...:|:..|..::||.|:|   
Human   211 DSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFG--- 272

  Fly   254 GSIPEL-LQQWEQRILAYRNYWEEEKNY 280
            |::|.. :..|.:.:|.  ..:.:|.:|
Human   273 GTLPPYDMGTWARTLLG--PDYSDENDY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 15/42 (36%)
SEC14 96..252 CDD:238099 44/166 (27%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 19/51 (37%)
CRAL_TRIO 125..274 CDD:306996 40/152 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145890
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.