DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:335 Identity:66/335 - (19%)
Similarity:125/335 - (37%) Gaps:87/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKID 71
            |||: |:.|:....|          .|:|.:...|    :.||.||:.:||...|.|::::..: 
Mouse     8 LSPQ-QQEALARFRE----------TLQDLLPTLP----KADDYFLLRWLRARNFDLKKSEDML- 56

  Fly    72 RFYTLRTKYPEFYLGHNVD---VDKALEIFRLGTIVILPRPLNDNGPRLALLRMAC--------- 124
                  .|:.||....|:|   ..:|.|:.:          |.|:|.........|         
Mouse    57 ------RKHVEFRNQQNLDQILTWQAPEVIQ----------LYDSGGLSGYDYEGCPVWFDIIGT 105

  Fly   125 YDPS----KYTLQEVNRAAGLMQQIMLDEDDVAI------VNGLISILDLSNVTTGHFLQMSPSF 179
            .||.    ..:.|::.|....:.:::|.|.::..      :..::.:.|:..::..|..:.:...
Mouse   106 MDPKGLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEV 170

  Fly   180 AKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW-EALYNQIPKQ 243
            .::.....|...|...:.:..|..|..|...||::|..|.::.|.::.:.|..| :.|...:...
Mouse   171 YQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPD 235

  Fly   244 YLPVEYGGE----------------NGSIPELLQQWEQRILAYRNYWEEEKNYGTDESLRVGQ-- 290
            .||||:||.                .|.:|:            |.|...::....:.|:.||:  
Mouse   236 QLPVEFGGTMTDPDGNPKCLTKINYGGEVPK------------RYYLSNQERPQYEHSVVVGRGS 288

  Fly   291 --PVDFESLF 298
              .|:.|.||
Mouse   289 SHQVENEILF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/41 (27%)
SEC14 96..252 CDD:238099 31/175 (18%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 13/66 (20%)
SEC14 77..244 CDD:214706 31/176 (18%)
GOLD_2 284..379 CDD:290608 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.