DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34001 and AT5G52220

DIOPT Version :9

Sequence 1:NP_001033999.2 Gene:CG34001 / 3885640 FlyBaseID:FBgn0054001 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_200035.4 Gene:AT5G52220 / 835298 AraportID:AT5G52220 Length:145 Species:Arabidopsis thaliana


Alignment Length:137 Identity:36/137 - (26%)
Similarity:59/137 - (43%) Gaps:46/137 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DWAIIELQGDLEVRSN-----QDMHGQFIGDLYY--NKYGQPILIIGHHILQGREQKLDKPFAVL 71
            :|||:||||.:|.:::     |::.   ||.|.:  :..|.....:|:|.|.|.:..|.||..||
plant    16 EWAIVELQGVVETQASFQGSIQNLE---IGRLCHSDSSQGTYTFTVGYHELVGSKVTLKKPLLVL 77

  Fly    72 EKSKTNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVRAVCTKKLIFKS 136
            :|.:.:|                                    .|.:.||..|..:...|::||:
plant    78 KKLQFDE------------------------------------VSGKATELEVVGIIRTKILFKT 106

  Fly   137 RPKPIIA 143
            ||||:|:
plant   107 RPKPLIS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34001NP_001033999.2 None
AT5G52220NP_200035.4 Ctf8 15..111 CDD:286742 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551444at2759
OrthoFinder 1 1.000 - - FOG0005631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104904
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.