DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34001 and CHTF8

DIOPT Version :9

Sequence 1:NP_001033999.2 Gene:CG34001 / 3885640 FlyBaseID:FBgn0054001 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001034779.1 Gene:CHTF8 / 54921 HGNCID:24353 Length:121 Species:Homo sapiens


Alignment Length:148 Identity:55/148 - (37%)
Similarity:76/148 - (51%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IVVKTQNA-GKGDWAIIELQGDLEVRSNQDMHGQFIGDLYYNKYGQPILIIGHHILQGREQKLDK 66
            ||:.:..| |..:|.::||||::|.|.:..:.|..:|||:|...|.|:||:|||||.|:...|:|
Human     4 IVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEK 68

  Fly    67 PFAVLEKSKTNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVRAVCTKK 131
            |||||.|....:           ||...|...||                   |.|.|.|:...|
Human    69 PFAVLVKHTPGD-----------QDCDELGRETG-------------------TRYLVTALIKDK 103

  Fly   132 LIFKSRPKPIIANVAKSV 149
            ::||:||||||.:|.|.|
Human   104 ILFKTRPKPIITSVPKKV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34001NP_001033999.2 None
CHTF8NP_001034779.1 Ctf8 13..113 CDD:286742 46/129 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142543
Domainoid 1 1.000 52 1.000 Domainoid score I11556
eggNOG 1 0.900 - - E1_2BWJ1
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H84588
Inparanoid 1 1.050 92 1.000 Inparanoid score I5099
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57204
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005631
OrthoInspector 1 1.000 - - oto90092
orthoMCL 1 0.900 - - OOG6_104904
Panther 1 1.100 - - LDO PTHR28605
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5048
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.