DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34001 and Chtf8

DIOPT Version :9

Sequence 1:NP_001033999.2 Gene:CG34001 / 3885640 FlyBaseID:FBgn0054001 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001181880.1 Gene:Chtf8 / 364996 RGDID:1306894 Length:121 Species:Rattus norvegicus


Alignment Length:148 Identity:56/148 - (37%)
Similarity:77/148 - (52%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IVVKTQNA-GKGDWAIIELQGDLEVRSNQDMHGQFIGDLYYNKYGQPILIIGHHILQGREQKLDK 66
            ||:.:..| |..:|.::||||::|.|.:..:.|..:|||:|...|.|:||:|||||.|:...|:|
  Rat     4 IVISSTGAEGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEK 68

  Fly    67 PFAVLEKSKTNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVRAVCTKK 131
            |||||.|.           :...||...|...||                   |:|.|.|:...|
  Rat    69 PFAVLVKH-----------TPGKQDCDELGRETG-------------------TQYLVTALIKNK 103

  Fly   132 LIFKSRPKPIIANVAKSV 149
            ::||:||||||.||.|.|
  Rat   104 ILFKTRPKPIITNVPKKV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34001NP_001033999.2 None
Chtf8NP_001181880.1 Ctf8 13..113 CDD:401584 46/129 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336045
Domainoid 1 1.000 53 1.000 Domainoid score I11133
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H84588
Inparanoid 1 1.050 94 1.000 Inparanoid score I4974
OMA 1 1.010 - - QHG57204
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005631
OrthoInspector 1 1.000 - - oto97210
orthoMCL 1 0.900 - - OOG6_104904
Panther 1 1.100 - - LDO PTHR28605
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.