DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34001 and ctf8

DIOPT Version :9

Sequence 1:NP_001033999.2 Gene:CG34001 / 3885640 FlyBaseID:FBgn0054001 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001018293.1 Gene:ctf8 / 3361556 PomBaseID:SPAC19D5.11c Length:109 Species:Schizosaccharomyces pombe


Alignment Length:129 Identity:28/129 - (21%)
Similarity:50/129 - (38%) Gaps:42/129 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IIELQGDLEVRSNQDMHGQFIGDLYY-----NKYGQPILIIGHHILQGREQKLDKPFAVLEKSKT 76
            ::|:|..|| |....:|   ||||..     ::..:..|.:|:..::|..:.|.||.|||:|:..
pombe    16 LVEVQATLE-RKADSLH---IGDLKIIKEKNSEKKKATLTVGNQYMEGVVESLKKPLAVLQKTNA 76

  Fly    77 NEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVRAVCTKKLIFKSRPKP 140
            :.                           :|...:..|      |....::..:::.|.|||.|
pombe    77 DP---------------------------VDVYSSPSH------ELKCCSIIRERIRFSSRPLP 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34001NP_001033999.2 None
ctf8NP_001018293.1 Ctf8 <30..107 CDD:286742 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104904
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.