DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34001 and ctf-8

DIOPT Version :9

Sequence 1:NP_001033999.2 Gene:CG34001 / 3885640 FlyBaseID:FBgn0054001 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_492190.2 Gene:ctf-8 / 188728 WormBaseID:WBGene00011915 Length:111 Species:Caenorhabditis elegans


Alignment Length:132 Identity:31/132 - (23%)
Similarity:55/132 - (41%) Gaps:36/132 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GKGDWAIIELQGDLEVRSNQDMHGQFIGDLYYNKYGQPILIIGHHILQGREQKLDKPFAVLEKSK 75
            |..:|..|||.|.:..:.:.....:.:|.:.:..:....::||:..|:|:..|:|:|..|::||.
 Worm    11 GTPEWMAIELHGAISPQDDGSFDSKTLGTICWGDHNNVYMVIGNQTLEGKISKIDRPLLVIQKSD 75

  Fly    76 TNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVRAVCTKKLIFKSRPKP 140
            .|                                    |:.......||.||..|||:||:||:|
 Worm    76 KN------------------------------------HQENGEKNATVNAVIRKKLVFKTRPRP 104

  Fly   141 II 142
            ::
 Worm   105 LV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34001NP_001033999.2 None
ctf-8NP_492190.2 Ctf8 <48..105 CDD:286742 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4069
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57204
OrthoDB 1 1.010 - - D1551444at2759
OrthoFinder 1 1.000 - - FOG0005631
OrthoInspector 1 1.000 - - oto19444
orthoMCL 1 0.900 - - OOG6_104904
Panther 1 1.100 - - LDO PTHR28605
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5048
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.900

Return to query results.
Submit another query.