DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG42397

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:205 Identity:41/205 - (20%)
Similarity:64/205 - (31%) Gaps:72/205 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TGSEVQRENTTDSSST-EITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIV 145
            :|.:...:.|||.|:| |.|:|      |::|||.|..                           
  Fly    23 SGEDTNIKLTTDESTTVEDTTE------VLVTTLPPPV--------------------------- 54

  Fly   146 TNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKC----DH-------- 198
              :|...|     ..||..: |.:||.|..|..:...|...|:::.....|    .|        
  Fly    55 --LCADED-----LFLPAPD-CREYYQCLYGEGILKICPDGLYWDRELNVCAWDSQHCADDKNET 111

  Fly   199 --PENVRCLAMTYNPREQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSCVAL 261
              |..:.|.:            .:...|:..:|..|.||.........||....|:...:||   
  Fly   112 TTPSTLNCAS------------GLPFLPYIPDCTKFIQCVYNIGFKLSCPSGLYWNQPLQSC--- 161

  Fly   262 GQAKCYNKLQ 271
             ...|.|.::
  Fly   162 -DYTCDNAIE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884
CBM_14 160..202 CDD:279884 12/55 (22%)
ChtBD2 215..259 CDD:214696 9/43 (21%)
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 11/49 (22%)
ChtBD2 125..163 CDD:214696 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.