Sequence 1: | NP_001034018.1 | Gene: | CG33985 / 3885639 | FlyBaseID: | FBgn0053985 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163428.1 | Gene: | CG42397 / 8673976 | FlyBaseID: | FBgn0259748 | Length: | 178 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 41/205 - (20%) |
---|---|---|---|
Similarity: | 64/205 - (31%) | Gaps: | 72/205 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 TGSEVQRENTTDSSST-EITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIV 145
Fly 146 TNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKC----DH-------- 198
Fly 199 --PENVRCLAMTYNPREQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSCVAL 261
Fly 262 GQAKCYNKLQ 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33985 | NP_001034018.1 | CBM_14 | 28..74 | CDD:279884 | |
CBM_14 | 160..202 | CDD:279884 | 12/55 (22%) | ||
ChtBD2 | 215..259 | CDD:214696 | 9/43 (21%) | ||
CG42397 | NP_001163428.1 | CBM_14 | 58..102 | CDD:279884 | 11/49 (22%) |
ChtBD2 | 125..163 | CDD:214696 | 10/41 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |