DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and Mur89F

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster


Alignment Length:268 Identity:60/268 - (22%)
Similarity:87/268 - (32%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FVTSPKSCAHYIFC-----NGD-ESYDGECEDGEYFSQDMEMCEPMGDI--DCRTGSEVQRENTT 92
            |...|:.|:.|..|     ||. :.|..:|..|..:....|.|.....:  :|.:|.......||
  Fly  1812 FFPDPEDCSRYYRCVDAAKNGKYQVYAFKCGKGTVWDTSTETCNYADQVSGNCSSGQTTTPGTTT 1876

  Fly    93 DSSSTEITSESSTISTVV-----ITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQL 152
            :..:||.|:.|....|..     .||.||....|..|....:.||.||:.:..   ..|...|:.
  Fly  1877 EPGTTESTTSSGKPETTSKAPENTTTWAPETTTTSSPETTTTVASETTTTTSG---TTTTATPET 1938

  Fly   153 DNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENVRCLAMTYNPREQCKR 217
            ..:                        |....|:......|.....|......|.:.|....|..
  Fly  1939 TTK------------------------PPKPETTTIAGEETSTSKSPTTTESPAPSTNTSAPCPE 1979

  Fly   218 ----HVIDVYP-----HSDNCNYFYQCRSG------YLMVQQCPFFYGWDYEKRSCVALGQAKCY 267
                ..:.|.|     |.:.|..||||...      .::|.|||  .|..|:.:|| :.|:....
  Fly  1980 TGPGQNVYVCPTGFRRHPEKCGMFYQCSESADNNDLNIVVFQCP--NGTVYQDKSC-SCGKPPAG 2041

  Fly   268 NKLQMQMK 275
            :|....||
  Fly  2042 DKCSKDMK 2049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 12/43 (28%)
CBM_14 160..202 CDD:279884 4/41 (10%)
ChtBD2 215..259 CDD:214696 16/58 (28%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.