DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and Gasp

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:131 Identity:36/131 - (27%)
Similarity:55/131 - (41%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 CPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNS-----LTGKCDHPENVRCLAMT 208
            ||     ......|:..||..|:.|..||:...:|...|.|::     ||..||:..||.|...|
  Fly    23 CP-----DDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRT 82

  Fly   209 -YNP---REQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSCVALGQA-KCYN 268
             ..|   ...|.| :..::|..:.|:.|:.|.:|.....||.....:|.:.|.|:...|. :|.|
  Fly    83 ELEPPITTPHCSR-LYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKN 146

  Fly   269 K 269
            :
  Fly   147 E 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884
CBM_14 160..202 CDD:279884 14/46 (30%)
ChtBD2 215..259 CDD:214696 11/43 (26%)
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/53 (28%)
CBM_14 97..144 CDD:366726 11/46 (24%)
CBM_14 170..218 CDD:366726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.