DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG17147

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:287 Identity:62/287 - (21%)
Similarity:104/287 - (36%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFGSILVSLLFLAT-----SHADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYDGE-----C 59
            ||.|.:|..:|.|||     |..:..:.|....|.:.|..|.:|..||.|     |||.     |
  Fly     4 LKLGVLLGCVLLLATVALSASVGEYEELCRLFKNGTKVRKPGTCDQYIQC-----YDGNGTVLTC 63

  Fly    60 EDGEYFSQDMEMCEPMGDIDCRTGSEVQRENTTD-------SSSTEITSESSTISTVVITTLAPS 117
            ...:.|:.....|     :|....|.....|..:       :..||.......::.|.:..:.| 
  Fly    64 PSNQSFNPSKGSC-----VDTLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCP- 122

  Fly   118 AVVTLRPSVNQSGASSTTSVSPAIE---IIVTNVCPQLDNQSRIALLPNQNSCSDYYICYR-GVA 178
                    |.|.....:.|....::   :.|.|:|..:...::..   |:..|:.||.|.: |..
  Fly   123 --------VGQHFDERSQSCLYGVDSMCVDVNNICELVAENTKFR---NEKDCAYYYECDKTGNH 176

  Fly   179 LPMSCATSL----HFNSLTGKCDHPENVRCLAMTYNPREQCKRHVIDVYPHSD--NCNYFYQCRS 237
            ...||..:.    :|:..:|.|.....|.|.|  ::....|.......: .||  .|..::.|::
  Fly   177 ASKSCTVTSKKREYFDVESGNCVEANKVECTA--HSKENVCTSSTTMTF-KSDQATCRGYFVCKA 238

  Fly   238 GYLMVQ------QCPFFYGWDYEKRSC 258
            .|.:..      |||..|.:|.:::.|
  Fly   239 LYPVADLDPLWTQCPEGYFFDEDRQLC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 14/50 (28%)
CBM_14 160..202 CDD:279884 11/46 (24%)
ChtBD2 215..259 CDD:214696 12/52 (23%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 11/42 (26%)
ChtBD2 89..136 CDD:214696 8/55 (15%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.