DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG6996

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:301 Identity:59/301 - (19%)
Similarity:104/301 - (34%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVLKFGSILVSLLFLATSHADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYFSQ 67
            |.|.|.:.|:..|.:               |.:.:..|::|..:|.|.......|.|..|.::.:
  Fly    19 GALTFNATLICSLVV---------------NGTKMNDPRACNAWIQCIDGSPVSGSCATGLFYDR 68

  Fly    68 DMEMCEPMGDIDCRTGSEVQRENT---------------TDSSSTEITSESSTISTVVITTLAPS 117
            :.:.|.....|.|.:........|               .|...|.                   
  Fly    69 ESQKCLSSSSIKCLSSDPCAALPTGFAADPYSCNGYYYCKDGKGTH------------------- 114

  Fly   118 AVVTLRPSVNQSGASSTTSVSPAI-EIIVTNVCPQLDNQSRIALLP------NQNSCSDYYICYR 175
                   .|..:|.:..:.....| :...:|   ::|..|...:||      :.::|:.|.:|:.
  Fly   115 -------GVCNTGMNFNSGTQDCIRDFPCSN---KMDPDSYCNILPDGVFVKDTDNCNGYQLCWD 169

  Fly   176 GVALPMSCATSLHFNSLTGKCDHPENVRCLAMTYNPREQCKRHVIDVYPH-----SDN--CNYFY 233
            |..:..:|..:.:|.:.|.:||:|:||.|   .:.|.....:.  .|.|.     |||  ||.:|
  Fly   170 GQVINGTCPGTFYFKASTAQCDYPQNVEC---DFVPVPDISKK--GVCPETGGFISDNKTCNGYY 229

  Fly   234 QCR---SGYLMVQQ--CP---FFYGWDYEKRSCVALGQAKC 266
            .|:   :|...::.  |.   ||...|  ..:||...:.||
  Fly   230 YCKDLGNGEFSLEHGVCSDGRFFLATD--GGACVPRSKVKC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 9/45 (20%)
CBM_14 160..202 CDD:279884 12/47 (26%)
ChtBD2 215..259 CDD:214696 14/58 (24%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 9/58 (16%)
ChtBD2 85..130 CDD:214696 5/70 (7%)
CBM_14 146..196 CDD:279884 12/49 (24%)
CBM_14 273..322 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.