DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG7290

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:292 Identity:57/292 - (19%)
Similarity:99/292 - (33%) Gaps:51/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLKFGSILVSLLFLATSHADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYFSQD 68
            :|...:::::....|.:..:|...|...:|.::|.|...|:.|..|.|.......|..|.||.::
  Fly     8 ILAAVALVIACAAPAIADVNVTALCLLVSNGNYVASQSDCSTYYQCQGSSFTAMSCPQGYYFDKN 72

  Fly    69 MEMCEPMGDIDCRTGSEVQRENTTDSSSTEITS-----------------------ESSTISTVV 110
            .:.|.......|.:.|:........|.:...:|                       ..:|::.|.
  Fly    73 AQQCTGTVPSTCTSNSDPCLGKAVGSFAASSSSCGGYYYCGASGAVRGNCPAGENFNPTTMACVY 137

  Fly   111 ITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYR 175
            ....         |....:|..||.||:       .|:|..:.|.....   :.:.||.:..|..
  Fly   138 KNNY---------PCSESAGDGSTVSVA-------LNLCNLVKNGFYFG---SPSDCSGWNFCQD 183

  Fly   176 GVALPMSCATSLHFNSLTGKCDHPENVRCLAMTYNPR-------EQCKRHVIDVYPHSDNCNYFY 233
            .|....||...|.||.....|.:.....|..:|.:|.       ..|......:  .:..||.:|
  Fly   184 NVLHSGSCEDGLVFNVQASNCGYKMASSCAQVTNDPSLTGVSAPTTCSSSGATI--AATACNQYY 246

  Fly   234 QCRSGYLMVQQCPFFYGWDYEKRSCVALGQAK 265
            .|.:|...:..||..|.:|...::||...:|:
  Fly   247 LCSAGNYQLMTCPSGYYYDTISKACVTRMEAR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 13/45 (29%)
CBM_14 160..202 CDD:279884 10/41 (24%)
ChtBD2 215..259 CDD:214696 10/43 (23%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884 12/44 (27%)
CBM_14 91..142 CDD:279884 4/59 (7%)
CBM_14 160..207 CDD:279884 12/49 (24%)
CBM_14 234..277 CDD:279884 11/44 (25%)
ChtBD2 <296..331 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.