DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG7248

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:254 Identity:60/254 - (23%)
Similarity:93/254 - (36%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TSHADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYD-GECEDGEYFSQDMEMCEPMGDIDCRT 82
            |...:.|.:|.|....:|...|::|..|.:|.|::||. ..|....:|:.....|.|  ||    
  Fly   198 TPAEESFTKCEDQEKGTFFPDPENCQQYYYCWGNKSYTILPCPVDNWFNPISGNCGP--DI---- 256

  Fly    83 GSEVQRENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTN 147
            ..:..||.|..|:.|..||.|        ||:||::.                      |..|.|
  Fly   257 APDACRETTPTSTPTIDTSSS--------TTVAPTST----------------------EDSVGN 291

  Fly   148 VCPQLDNQSRIALLPNQNSCSDYYICY-RGVALPMSCATSLHFNSLTGKC----------DHPEN 201
            .|.   :|...|..|.::.|..|.:|. .|.:....|.::..|:..||.|          :..|.
  Fly   292 PCA---DQELGASFPIKSDCQSYLLCLNNGESTTAKCPSNAWFDPKTGDCGPNVSPTACLESFET 353

  Fly   202 VRCLAMTYNPREQCKRHVIDV-YPHSDNCNYFYQCR-SGYLMVQQCPFFYGWDYEKRSC 258
            ......|..|::.|....:.. ||...||..:..|. :|...|..|.:...:|.:..:|
  Fly   354 TTTAVTTQAPKDPCADQELGTSYPLVTNCQQYILCMGNGESTVANCIYNSWFDPQTGNC 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 13/46 (28%)
CBM_14 160..202 CDD:279884 11/52 (21%)
ChtBD2 215..259 CDD:214696 11/46 (24%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884
CBM_14 207..261 CDD:279884 16/59 (27%)
CBM_14 293..347 CDD:279884 13/56 (23%)
CBM_14 367..421 CDD:279884 11/46 (24%)
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.