DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and obst-G

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:183 Identity:38/183 - (20%)
Similarity:65/183 - (35%) Gaps:52/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VTSPKSCAHYIFCNGDESYDGECEDGEYFSQDMEMCEPMGDIDCRTGSEVQRENTTDSSSTEITS 101
            :|...||..|..|...:.:...|.|.::||....:|....:..|..|:   |||           
  Fly   141 LTKNGSCQEYYVCKAKKPHLRSCPDKQHFSPTRRICMKASEAKCSGGT---REN----------- 191

  Fly   102 ESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNS 166
                                     .:|...:||.          .||   .::...:|:.:::.
  Fly   192 -------------------------KESDGPATTG----------GVC---SDEKENSLVAHRSD 218

  Fly   167 CSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENVRCLAMTYNPREQCKRHV 219
            |..:.:|...:.|.|.|.|.||||..|.:||:|:..:|.......:.:.|:.|
  Fly   219 CGKFMLCSNMMFLVMDCPTGLHFNIATSRCDYPKIAKCQTKLNESKSKSKKPV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 10/36 (28%)
CBM_14 160..202 CDD:279884 15/41 (37%)
ChtBD2 215..259 CDD:214696 2/5 (40%)
obst-GNP_648529.1 CBM_14 32..83 CDD:279884
CBM_14 132..184 CDD:279884 10/42 (24%)
CBM_14 204..256 CDD:279884 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.