DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG17826

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:95/245 - (38%) Gaps:49/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SHADVFD----ECNDGNNLS-----FVTSPKSCAHYIFCNGDESYDGECEDGEYFSQDMEMCEPM 75
            |.::|.|    :|| ||..:     ....|.:||.|:.|:.......:|.||.||:..:|.|...
  Fly   437 SQSEVCDVDNGQCN-GNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQCADGAYFNATLETCVQD 500

  Fly    76 GD---IDCRTGSEVQRENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSV------NQSGA 131
            .:   ::|:.||   .:...|.:..||.|...     .:|....|.......|.      .|...
  Fly   501 DEGICVNCKEGS---TKPLADCTMYEICSGGK-----YVTKSCDSGYYWNSQSEVCDVDNGQCNG 557

  Fly   132 SSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKC 196
            :.||.....:::                   |...|:.|..|..||.:...|:.:..||:...:|
  Fly   558 NGTTCTENEVKV-------------------NPADCAGYLQCINGVFVARKCSATQFFNTTLKEC 603

  Fly   197 D-HPENVRCLAMTYNPREQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQC 245
            : ..||| |:..|.:| :.|......::|...||:.||||.:|....|:|
  Fly   604 EVDTENV-CIPKTCDP-DCCDVPNNSIWPVEKNCSAFYQCVNGNKYEQRC 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 16/50 (32%)
CBM_14 160..202 CDD:279884 11/42 (26%)
ChtBD2 215..259 CDD:214696 11/31 (35%)
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884 12/38 (32%)
CBM_14 563..610 CDD:279884 11/65 (17%)
CBM_14 621..670 CDD:279884 11/31 (35%)
CBM_14 697..749 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.