DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG5883

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:302 Identity:67/302 - (22%)
Similarity:107/302 - (35%) Gaps:74/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SILVSLLFLA--------TSHADVFDE-C---NDGNNLSFVTSPKSCAHYIFCNGDESYDG-ECE 60
            |:::..|.||        |.:.:..|: |   .||..|   ..|.||:..|.|...||..| .|.
  Fly     7 SLVLQALLLAVMVHQSIQTRYLNATDDICRLFKDGTQL---LKPGSCSESIICQNFESTPGITCS 68

  Fly    61 DGE-YFSQDMEMCEPMGDIDCRT------------GSEVQRENTTDSSSTEITSESSTISTVVIT 112
            ..: |:|:....|:...|..|.|            |..:...|.....:..:..:.:....:...
  Fly    69 GSKPYYSKSKGSCQASADTYCDTSKICKGSGTGYIGDTINCANWYYCDADALLGKGTCNLGMYFD 133

  Fly   113 TLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYRGV 177
            .::.|.|.           |..|..:...||  .:|.| :....|     :..:|..||.|....
  Fly   134 QVSKSCVY-----------SEDTVCAAKYEI--CDVAP-VGTPFR-----DDANCHKYYTCSSKS 179

  Fly   178 ALPMSCATSLHFNSLTGKCDHPENVRCLAMTYN---PREQC--------KRHVIDVYPHSDNCNY 231
            .:..:|...|::|..||.|...::|.|    .|   |.|.|        .:.|.|:    ..|..
  Fly   180 LVENTCENGLYYNVATGTCVRKKDVIC----ENHPLPDEVCGNKKLAVRNKFVSDM----ATCRG 236

  Fly   232 FYQCR---SGY----LMVQQCPFFYGWDYEKRSCVALGQAKC 266
            :|.||   ||.    .:.|||.....::.|:::|:.....||
  Fly   237 YYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 16/50 (32%)
CBM_14 160..202 CDD:279884 10/41 (24%)
ChtBD2 215..259 CDD:214696 13/58 (22%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 5/61 (8%)
CBM_14 154..204 CDD:279884 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.