DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and Muc68D

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:260 Identity:56/260 - (21%)
Similarity:88/260 - (33%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYFSQDMEMCEPMGDIDCRTGSE 85
            |.:...:|::..|..|:...:||..|..|...::..|.|....:|....::|.....:||.... 
  Fly  1307 HQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDCPLDE- 1370

  Fly    86 VQRENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCP 150
                                         ||.. ||.:||..:|                |..|.
  Fly  1371 -----------------------------APEN-VTKKPSDTES----------------TPDCK 1389

  Fly   151 QLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENVRCL---------- 205
            .|.|.   |.:.:..|||.:|:|..|.|:|..|...|||:..:..|::|..|:|.          
  Fly  1390 SLRNG---AYVRDPKSCSRFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQCSLEESQADAHG 1451

  Fly   206 AMTYNPREQCKR-----HVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSCVALGQAK 265
            |:.......|.:     ...||..|    |.:|.|..|..::..|.....:|...:.|:....||
  Fly  1452 ALLAEGVPDCTKVKEDTRFGDVKQH----NKYYVCLKGKAVLHYCSPGNWFDLRSQKCIDQRLAK 1512

  Fly   266  265
              Fly  1513  1512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 11/45 (24%)
CBM_14 160..202 CDD:279884 14/41 (34%)
ChtBD2 215..259 CDD:214696 10/48 (21%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 11/51 (22%)
CBM_14 1388..1440 CDD:279884 19/54 (35%)
ChtBD2 1459..1505 CDD:214696 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.