DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG33986

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:264 Identity:70/264 - (26%)
Similarity:106/264 - (40%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NNL--SFVTSPKSCAHYIFC--NGDESYDGECEDGEYFSQDMEMCEPMGDIDCRTGSEVQRENTT 92
            |:|  .||...:.|..:..|  ||| :....|.....|:.:..:|:...::.||        |.|
  Fly    43 NHLVGEFVEHAEDCHMFYLCVENGD-AVLASCPPTMLFNSESRLCDSATNVKCR--------NET 98

  Fly    93 DSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQLDNQSR 157
            |...|......:....       |:.:||          .:.|..|..:|        |..:..|
  Fly    99 DPIETPPFDGGNGDGD-------PNNMVT----------DAATYCSTLVE--------QQQSSDR 138

  Fly   158 IALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENVRCLA-----MTYNPRE---- 213
            |..:.:.:||..|||||.|.|:...|::.||:|::|||||.||..:|..     |..|...    
  Fly   139 IVYVGSSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPS 203

  Fly   214 ----------QCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSCVALGQAKCYN 268
                      .|..:...:|||...|.:|..|..|:..:|||||:|.:|...:||.....|:|..
  Fly   204 GGTAISSDLIHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQWSRTAQCVR 268

  Fly   269 KLQM 272
            .|.:
  Fly   269 DLNL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 12/45 (27%)
CBM_14 160..202 CDD:279884 20/41 (49%)
ChtBD2 215..259 CDD:214696 16/43 (37%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 12/49 (24%)
CBM_14 141..185 CDD:279884 20/43 (47%)
ChtBD2 213..261 CDD:214696 17/47 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470256
Domainoid 1 1.000 42 1.000 Domainoid score I19583
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.