DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG4835

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:339 Identity:67/339 - (19%)
Similarity:111/339 - (32%) Gaps:122/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYFSQDMEMCEPMGDIDC---RTGSEVQ 87
            ::|.|..:.:......:|:.|:.|..::...|.|.....|:.|:.:|:...|:.|   ||.:.: 
  Fly   391 NDCKDEKDGTIFAYIGNCSEYLICKDNQVQMGHCPPNTLFNPDLLVCDEPDDVVCLGDRTTTPI- 454

  Fly    88 RENTTDSSSTEITSESSTISTVVITTLAPSAVV---------------------------TLR-- 123
             ..|..:::||.|:.::| :|.|.|||.|..:.                           ||.  
  Fly   455 -PTTIPTTTTEKTTPTTT-TTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLCLGGGQWTLAPC 517

  Fly   124 -------PSVNQSGAS----------------------------------------STTSVSPAI 141
                   ||..|.|..                                        :||:|:|. 
  Fly   518 IYGSYFDPSTGQCGPDVAPDACKPSQVTTTTTTTTTETTTTERNTTPKSTATTTERTTTTVAPK- 581

  Fly   142 EIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGK---------CD 197
                |.:|...:....||.   .|:|:.|.:|...:.:...|.....|:|...|         |:
  Fly   582 ----TGICGGRNENENIAY---PNNCTKYIVCVSPIPIAFFCPDGTFFSSKLEKCIDDWDESDCE 639

  Fly   198 HPENVRCLAMTYN--PRE--QCKRHVIDVYPHSDNCNYFYQCRSGYLM---VQQCPFFYG----- 250
            ..::...|...|.  |.|  .|.....|.:|:.|||.:|.:|...|:.   |..|..:|.     
  Fly   640 GDQSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQWFIRCVDDYIYMMDVCNCGEYYDPITEK 704

  Fly   251 -----------WDY 253
                       |||
  Fly   705 CGADVPSDACRWDY 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 10/45 (22%)
CBM_14 160..202 CDD:279884 9/50 (18%)
ChtBD2 215..259 CDD:214696 15/58 (26%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 11/50 (22%)
CBM_14 485..539 CDD:279884 6/53 (11%)
CBM_14 585..638 CDD:279884 11/55 (20%)
CBM_14 661..714 CDD:279884 12/52 (23%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.