Sequence 1: | NP_001034018.1 | Gene: | CG33985 / 3885639 | FlyBaseID: | FBgn0053985 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_647965.3 | Gene: | CG4835 / 38619 | FlyBaseID: | FBgn0035607 | Length: | 1224 | Species: | Drosophila melanogaster |
Alignment Length: | 339 | Identity: | 67/339 - (19%) |
---|---|---|---|
Similarity: | 111/339 - (32%) | Gaps: | 122/339 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 DECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYFSQDMEMCEPMGDIDC---RTGSEVQ 87
Fly 88 RENTTDSSSTEITSESSTISTVVITTLAPSAVV---------------------------TLR-- 123
Fly 124 -------PSVNQSGAS----------------------------------------STTSVSPAI 141
Fly 142 EIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGK---------CD 197
Fly 198 HPENVRCLAMTYN--PRE--QCKRHVIDVYPHSDNCNYFYQCRSGYLM---VQQCPFFYG----- 250
Fly 251 -----------WDY 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33985 | NP_001034018.1 | CBM_14 | 28..74 | CDD:279884 | 10/45 (22%) |
CBM_14 | 160..202 | CDD:279884 | 9/50 (18%) | ||
ChtBD2 | 215..259 | CDD:214696 | 15/58 (26%) | ||
CG4835 | NP_647965.3 | CBM_14 | 51..103 | CDD:279884 | |
CBM_14 | 185..237 | CDD:279884 | |||
CBM_14 | 273..322 | CDD:279884 | |||
CBM_14 | 393..444 | CDD:279884 | 11/50 (22%) | ||
CBM_14 | 485..539 | CDD:279884 | 6/53 (11%) | ||
CBM_14 | 585..638 | CDD:279884 | 11/55 (20%) | ||
CBM_14 | 661..714 | CDD:279884 | 12/52 (23%) | ||
CBM_14 | 744..796 | CDD:279884 | |||
CBM_14 | 914..962 | CDD:279884 | |||
CBM_14 | 1175..1212 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |