DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and obst-B

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:265 Identity:56/265 - (21%)
Similarity:82/265 - (30%) Gaps:111/265 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYF---SQDMEMCEPMGDIDCRTGSEVQ 87
            :||.:.|  .|....|.|..|..|......:..|.||..|   |...|.|:...:|||...|::|
  Fly    84 EECPEPN--GFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRSKLQ 146

  Fly    88 RENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQL 152
                                             |.:||::                     ||: 
  Fly   147 ---------------------------------TPQPSLH---------------------CPR- 156

  Fly   153 DNQSRIALLPNQNS---------CSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENV------ 202
                       :|.         |..:|.|..|....::|...|.||..||.|..|:.|      
  Fly   157 -----------KNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCK 210

  Fly   203 -------RC------LAMTYNPREQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQ-CPFFYGWDY 253
                   .|      :|:|: ||          |...::|.:||.|.:|.|..:. |.....:|.
  Fly   211 SEDVFDFECPKVNESIAVTH-PR----------YADPNDCQFFYVCVNGDLPRRNGCKLGQVFDE 264

  Fly   254 EKRSC 258
            ||.:|
  Fly   265 EKETC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 14/48 (29%)
CBM_14 160..202 CDD:279884 13/50 (26%)
ChtBD2 215..259 CDD:214696 12/45 (27%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 14/51 (27%)
CBM_14 156..204 CDD:279884 13/59 (22%)
CBM_14 233..278 CDD:279884 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.