DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and obst-E

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:296 Identity:59/296 - (19%)
Similarity:90/296 - (30%) Gaps:94/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFGVLKFGSILVSLLFLATSHADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYF 65
            |||.:..||                .||...|..  ..|...|..|..|......:..|.||..|
  Fly    14 MFGSMALGS----------------PECPTPNGR--FASGDQCDSYTECQDGTPVEKLCPDGLLF 60

  Fly    66 SQDMEMCEPMGDIDCRTGSEVQRENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSG 130
            .|                            .|:.|.|         .|.||.:....|..:..:.
  Fly    61 HQ----------------------------RTKATGE---------CTYAPYSTCKERARLQPAN 88

  Fly   131 ASSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNS--CSDYYICYRGVALPMSCATSLHFNSLT 193
            .              |..||:     :....||.::  |..|..|..|||....|...|.||..|
  Fly    89 G--------------TEECPR-----QFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEET 134

  Fly   194 GKCDHPENVR-CLAMTY--------NPREQCKRHVIDV--------YPHSDNCNYFYQCRSGYLM 241
            .:||.|:.|. |.|..|        :..:......:||        |.|...|..::.|.:|:..
  Fly   135 YQCDWPDLVESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPR 199

  Fly   242 VQQCPFFYGWDYEKRSCVALGQA-KCYNKLQMQMKI 276
            :..|..:..::.:.:.|....:. :||..|:.:.::
  Fly   200 LYNCGKYLAFNSQTKLCDFYNKVPECYALLKEKQRL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 11/45 (24%)
CBM_14 160..202 CDD:279884 16/43 (37%)
ChtBD2 215..259 CDD:214696 8/51 (16%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 12/71 (17%)
CBM_14 95..146 CDD:307643 17/55 (31%)
CBM_14 180..225 CDD:307643 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.