DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG31077

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:338 Identity:65/338 - (19%)
Similarity:118/338 - (34%) Gaps:104/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSLLFLATSHADVFDECNDG----NNLSFV-----TSPKSCAHYIFCNGDESYDGECEDGEYFSQ 67
            :||.|......|..| .|.|    ||..|:     .:|:.||.||.|.|..:.:.:|:.|.||::
  Fly   618 LSLQFTTLDGVDNLD-INTGTCVYNNTLFIEGIREVNPQDCAGYIECFGGVAKELKCDSGRYFNE 681

  Fly    68 DMEMCEPMGDIDCRTGSE---VQRENTTDSSSTEITS---------------------------- 101
            ....|....|..|....:   :..:.||:|:....||                            
  Fly   682 TQRNCSVDVDEICLKSDKTIVLDLQTTTESTPNFTTSVDPFAKCRDGQLRLDPKNCAGFLKCVDG 746

  Fly   102 ---ESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQLDNQSRIALLPN 163
               |....|.....:.:...:|.:|       |:..|::...||.:...               :
  Fly   747 ELKEEMCPSGFFYNSTSSKCMVDIR-------ATCVTNIKYCIEGVREE---------------D 789

  Fly   164 QNSCSDYYICYRGVALPMSCATSLHFN--------SLTGKCDHPENV------------------ 202
            .|:|:.|..|.||:...::|....:||        .:...|...|.|                  
  Fly   790 PNNCAGYRQCIRGLVQNLNCPLGQYFNVAERDCLMDVHKVCARTEEVYKSDEVQHNDTGPPMTKP 854

  Fly   203 --RCL----AMTYNPREQCK--RHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSCV 259
              .|:    .:..:|..:|:  :|.:|    .:||..:.:|::|.|:.:.||..:.:|:..:.|:
  Fly   855 DESCIRDINGVCVDPLAKCREGQHKLD----PNNCAGYLKCQNGELIEELCPNGFYYDFLMKICL 915

  Fly   260 ALGQAKCYNKLQM 272
            ...:..|...:|:
  Fly   916 VDRRGICVTNIQI 928

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 17/54 (31%)
CBM_14 160..202 CDD:279884 11/49 (22%)
ChtBD2 215..259 CDD:214696 11/45 (24%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 2/35 (6%)
CBM_14 881..914 CDD:279884 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.