DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and obst-I

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_728731.1 Gene:obst-I / 317966 FlyBaseID:FBgn0052304 Length:219 Species:Drosophila melanogaster


Alignment Length:96 Identity:21/96 - (21%)
Similarity:34/96 - (35%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 YICYRGVALPMSCATSLHFNSLTGKCDHPENVRCLAMTYNPREQCKRHVIDVYPHSDNCNYFYQC 235
            |:..|..|...||....:||.....|...:..           .|..|.|...|.:...:.|..|
  Fly    27 YLELRLDAAAESCPDDYYFNETIQACVSTDTT-----------SCTNHQIGKCPMATEMDEFCVC 80

  Fly   236 RSGYLMVQQCPFFYGWDYEKRSCVALGQAKC 266
            :..:|.:.:||....:|..:..| .:|..:|
  Fly    81 KDKHLQIWKCPEGTYFDANRLVC-RVGSVEC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884
CBM_14 160..202 CDD:279884 8/30 (27%)
ChtBD2 215..259 CDD:214696 10/43 (23%)
obst-INP_728731.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.