DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and Mur2B

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:147 Identity:31/147 - (21%)
Similarity:50/147 - (34%) Gaps:44/147 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PQLDNQSRIALLPNQNSCSDYYICYRGVALP--MSCATSLHFNSLTGKCDHPENVRCLAMTYNPR 212
            ||...:.|   .|:.:.|..||.|.:....|  .:|.....|:.:..||             .|.
  Fly   147 PQCQKEGR---FPHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKC-------------LPG 195

  Fly   213 EQCKRHVID---------------------VYPHSDNCNYFYQCR---SG-YLMVQ-QCPFFYGW 251
            :||....|.                     .:....:|..:|.||   || ||..: :||....:
  Fly   196 DQCPSTEISDSGSYIPQNCELKFPECAEEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSF 260

  Fly   252 DYEKRSCVALGQAKCYN 268
            |.|::.|....:..|::
  Fly   261 DLERKLCRPRSEVDCFD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884
CBM_14 160..202 CDD:279884 10/43 (23%)
ChtBD2 215..259 CDD:214696 14/69 (20%)
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:279884 12/62 (19%)
CBM_14 221..275 CDD:279884 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.