DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and Muc68E

DIOPT Version :10

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:216 Identity:58/216 - (26%)
Similarity:91/216 - (42%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PMGDIDCRTGSEVQRENTTDSSSTEITS-----ESSTI------------------STVVI--TT 113
            |:.|    |.:.|.::.|||.|||.:|:     ||:|:                  ||.::  ||
  Fly  1533 PIPD----TSTTVNQDTTTDESSTVVTTTNIPKESTTLGDSTLSPGENSTAGQVSTSTTLVYDTT 1593

  Fly   114 LAP----SAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICY 174
            .:|    |...||.||.:.|..::|:|:            |.|...:....||:..:|..|..|.
  Fly  1594 SSPIPSSSRSTTLEPSSSSSPETTTSSL------------PPLSCSTGYQYLPHPTNCHKYIHCS 1646

  Fly   175 RGVALPMSCATSLHFNSLTGKCDHPENVRCLAMT--YNPREQCKRHVIDVYPHSDNCNYFYQCRS 237
            .|..|.|.|..:|:::.....|.....| |...|  .||.|:.....:|...|..:|..:.||.:
  Fly  1647 NGHELIMECPANLYWDYHKFVCSGDSGV-CYNDTENSNPEEKVCGPGVDFLAHPTDCTMYLQCSN 1710

  Fly   238 GYLMVQQCPFFYGWDYEKRSC 258
            |..:.::||....|:.|.:||
  Fly  1711 GVALERKCPDPLYWNPEIKSC 1731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:426342 58/216 (27%)
CBM_14 160..202 CDD:426342 11/41 (27%)
ChtBD2 215..259 CDD:214696 12/44 (27%)
Muc68ENP_996064.1 rne <158..303 CDD:236766
MDN1 300..1293 CDD:444083
rne <1358..1503 CDD:236766
ChtBD2 1626..1668 CDD:214696 10/41 (24%)
ChtBD2 1688..1734 CDD:214696 12/44 (27%)
ChtBD2 <1761..1791 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.