DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and cbd-1

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_502145.2 Gene:cbd-1 / 178061 WormBaseID:WBGene00010351 Length:1319 Species:Caenorhabditis elegans


Alignment Length:318 Identity:75/318 - (23%)
Similarity:107/318 - (33%) Gaps:117/318 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NDGNNLSFVT-----SPKSCAHYIFCNGDE-----SY---DGECEDGEYFSQDME---------- 70
            |||...:::|     |......|....|||     ||   |.:.||.|  ..|:|          
 Worm   975 NDGPTDTYITGSTKYSTTDSGEYTIPYGDETTSTRSYDRADNDSEDEE--EDDVEHDQKCTVGSR 1037

  Fly    71 -----------MCEPMGDID--CRTGSEVQRENTTDSSSTEITSE--------SSTISTVVITTL 114
                       .|...|:::  ||.|      ...||.|......        ...|..::.||.
 Worm  1038 TPVGFCVRTYLECTDAGNVEKLCRIG------KLFDSHSNRCVPRIGCGKEAIRDAIKDMIATTP 1096

  Fly   115 APS---------------AVVT--------LRPS-----------------------VNQSGASS 133
            ||:               ||.:        ||.|                       |.:|.::.
 Worm  1097 APAQPKQFEGRCAHVDGEAVFSIGVCSSKYLRCSYGASKLQQCSEDRVFSNDKLECIVRESVSAC 1161

  Fly   134 TTSVSPAIEIIVTNVCPQLDNQSRI------ALLPNQNSCSDYYICYRGVALP-MSCATSLHFNS 191
            |...:|:|:...|:     ::||..      .|..|:..||....|:.|.... .||.:||.||.
 Worm  1162 TVPKNPSIKKYYTS-----NDQSAFCDGKEDGLYRNERDCSAILQCFGGELFEHPSCQSSLAFNQ 1221

  Fly   192 LTGKCDHPENVRCLAMTYNPREQCKRH---VIDVYPHSDNCNYFYQCRSGYLMVQQCP 246
            ||||||:|:.|...........:|..|   :.|    ::||..||:|..|..:|..||
 Worm  1222 LTGKCDYPQKVSGCENHGQTNGECSEHGSFIAD----ANNCEVFYRCVWGRKVVMTCP 1275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 18/78 (23%)
CBM_14 160..202 CDD:279884 19/42 (45%)
ChtBD2 215..259 CDD:214696 12/35 (34%)
cbd-1NP_502145.2 ChtBD2 97..141 CDD:214696
ChtBD2 191..237 CDD:214696
CBM_14 692..743 CDD:307643
CBM_14 785..836 CDD:307643
CBM_14 1108..1161 CDD:307643 7/52 (13%)
CBM_14 1182..1235 CDD:307643 20/52 (38%)
CBM_14 1251..1296 CDD:307643 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.